SCOPe 2.01: Domain d2ak4q1: 2ak4 Q:182-276

Lineage for d2ak4q1 (2ak4 Q:182-276)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d2ak4q1: 2ak4 Q:182-276 [126909]
   Other proteins in same PDB: d2ak4a2, d2ak4b_, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f2, d2ak4g_, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k2, d2ak4l_, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4q2, d2ak4r_, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2
   automatically matched to d1a1ma1
   complexed with iod

Details for d2ak4q1

PDB Entry: 2ak4, 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide

PDB Compounds: (Q:) HLA-B35 variant

SCOPe Domain Sequences for d2ak4q1:

Sequence; same for both SEQRES and ATOM records:

>d2ak4q1 b.1.1.2 (Q:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d2ak4q1:

• d2ak4q1 first appeared in SCOP 1.73
  
• d2ak4q1 appears in SCOP 1.75
  
• d2ak4q1 appears in SCOPe 2.02
  
• d2ak4q1 appears in the current release, SCOPe 2.08