Lineage for d2ak4k2 (2ak4 K:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719536Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (21 PDB entries)
  8. 719558Domain d2ak4k2: 2ak4 K:1-181 [126907]
    Other proteins in same PDB: d2ak4a1, d2ak4b1, d2ak4f1, d2ak4g1, d2ak4k1, d2ak4l1, d2ak4q1, d2ak4r1
    automatically matched to d1a1ma2
    complexed with iod

Details for d2ak4k2

PDB Entry: 2ak4 (more details), 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
PDB Compounds: (K:) HLA-B35 variant

SCOP Domain Sequences for d2ak4k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak4k2 d.19.1.1 (K:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqrrayleglcvewlrrylengketlq
r

SCOP Domain Coordinates for d2ak4k2:

Click to download the PDB-style file with coordinates for d2ak4k2.
(The format of our PDB-style files is described here.)

Timeline for d2ak4k2: