SCOP 1.73: Domain d2ak4k2: 2ak4 K:1-181

Lineage for d2ak4k2 (2ak4 K:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (21 PDB entries)

8. Domain d2ak4k2: 2ak4 K:1-181 [126907]
   Other proteins in same PDB: d2ak4a1, d2ak4b1, d2ak4f1, d2ak4g1, d2ak4k1, d2ak4l1, d2ak4q1, d2ak4r1
   automatically matched to d1a1ma2
   complexed with iod

Details for d2ak4k2

PDB Entry: 2ak4, 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide

PDB Compounds: (K:) HLA-B35 variant

SCOP Domain Sequences for d2ak4k2:

Sequence; same for both SEQRES and ATOM records:

>d2ak4k2 d.19.1.1 (K:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprapwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqrrayleglcvewlrrylengketlq
r

Timeline for d2ak4k2:

• d2ak4k2 is new in SCOP 1.73
  
• d2ak4k2 appears in SCOP 1.75
  
• d2ak4k2 appears in the current release, SCOPe 2.08