Lineage for d2ak4k1 (2ak4 K:182-276)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1759809Species Human (Homo sapiens) [TaxId:9606] [88605] (189 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1760011Domain d2ak4k1: 2ak4 K:182-276 [126906]
    Other proteins in same PDB: d2ak4a2, d2ak4b_, d2ak4d1, d2ak4d2, d2ak4e1, d2ak4e2, d2ak4f2, d2ak4g_, d2ak4i1, d2ak4i2, d2ak4j1, d2ak4j2, d2ak4k2, d2ak4l_, d2ak4n1, d2ak4n2, d2ak4p1, d2ak4p2, d2ak4q2, d2ak4r_, d2ak4t1, d2ak4t2, d2ak4u1, d2ak4u2
    automatically matched to d1a1ma1
    complexed with iod

Details for d2ak4k1

PDB Entry: 2ak4 (more details), 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
PDB Compounds: (K:) HLA-B35 variant

SCOPe Domain Sequences for d2ak4k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak4k1 b.1.1.2 (K:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d2ak4k1:

Click to download the PDB-style file with coordinates for d2ak4k1.
(The format of our PDB-style files is described here.)

Timeline for d2ak4k1: