Lineage for d2ak4f1 (2ak4 F:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654675Domain d2ak4f1: 2ak4 F:182-276 [126903]
    Other proteins in same PDB: d2ak4a2, d2ak4b1, d2ak4f2, d2ak4g1, d2ak4k2, d2ak4l1, d2ak4q2, d2ak4r1
    automatically matched to d1a1ma1
    complexed with iod

Details for d2ak4f1

PDB Entry: 2ak4 (more details), 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide
PDB Compounds: (F:) HLA-B35 variant

SCOP Domain Sequences for d2ak4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ak4f1 b.1.1.2 (F:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d2ak4f1:

Click to download the PDB-style file with coordinates for d2ak4f1.
(The format of our PDB-style files is described here.)

Timeline for d2ak4f1: