SCOP 1.73: Domain d2ak4f1: 2ak4 F:182-276

Lineage for d2ak4f1 (2ak4 F:182-276)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d2ak4f1: 2ak4 F:182-276 [126903]
   Other proteins in same PDB: d2ak4a2, d2ak4b1, d2ak4f2, d2ak4g1, d2ak4k2, d2ak4l1, d2ak4q2, d2ak4r1
   automatically matched to d1a1ma1
   complexed with iod

Details for d2ak4f1

PDB Entry: 2ak4, 2.5 Å

PDB Description: Crystal Structure of SB27 TCR in complex with HLA-B*3508-13mer peptide

PDB Compounds: (F:) HLA-B35 variant

SCOP Domain Sequences for d2ak4f1:

Sequence; same for both SEQRES and ATOM records:

>d2ak4f1 b.1.1.2 (F:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d2ak4f1:

• d2ak4f1 is new in SCOP 1.73
  
• d2ak4f1 appears in SCOP 1.75
  
• d2ak4f1 appears in the current release, SCOPe 2.08