Lineage for d2ajtc1 (2ajt C:329-498)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952100Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (2 families) (S)
  5. 952110Family b.43.2.2: AraA C-terminal domain-like [141331] (1 protein)
    C-terminal part of Pfam PF02610
  6. 952111Protein L-arabinose isomerase AraA [141332] (1 species)
  7. 952112Species Escherichia coli [TaxId:562] [141333] (2 PDB entries)
    Uniprot P08202 329-498
  8. 952115Domain d2ajtc1: 2ajt C:329-498 [126898]
    Other proteins in same PDB: d2ajta2, d2ajtb2, d2ajtc2
    automatically matched to 2AJT A:329-498

Details for d2ajtc1

PDB Entry: 2ajt (more details), 2.6 Å

PDB Description: crystal structure of l-arabinose isomerase from e.coli
PDB Compounds: (C:) L-arabinose isomerase

SCOPe Domain Sequences for d2ajtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajtc1 b.43.2.2 (C:329-498) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]}
tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt
gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga
hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf

SCOPe Domain Coordinates for d2ajtc1:

Click to download the PDB-style file with coordinates for d2ajtc1.
(The format of our PDB-style files is described here.)

Timeline for d2ajtc1: