SCOP 1.75: Domain d2ajtb1: 2ajt B:329-498

Lineage for d2ajtb1 (2ajt B:329-498)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (2 families)

5. Family b.43.2.2: AraA C-terminal domain-like [141331] (1 protein)
   C-terminal part of Pfam PF02610

6. Protein L-arabinose isomerase AraA [141332] (1 species)

7. Species Escherichia coli [TaxId:562] [141333] (2 PDB entries)
   Uniprot P08202 329-498

8. Domain d2ajtb1: 2ajt B:329-498 [126896]
   Other proteins in same PDB: d2ajta2, d2ajtb2, d2ajtc2
   automatically matched to 2AJT A:329-498

Details for d2ajtb1

PDB Entry: 2ajt, 2.6 Å

PDB Description: crystal structure of l-arabinose isomerase from e.coli

PDB Compounds: (B:) L-arabinose isomerase

SCOP Domain Sequences for d2ajtb1:

Sequence; same for both SEQRES and ATOM records:

>d2ajtb1 b.43.2.2 (B:329-498) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]}
tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt
gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga
hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf

Timeline for d2ajtb1:

• d2ajtb1 first appeared in SCOP 1.73
  
• d2ajtb1 appears in SCOPe 2.01
  
• d2ajtb1 appears in the current release, SCOPe 2.08