Lineage for d2ajta2 (2ajt A:1-328)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1183821Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 1183822Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (2 families) (S)
  5. 1183832Family c.85.1.2: AraA N-terminal and middle domain-like [142760] (1 protein)
    N-terminal part of Pfam PF02610
  6. 1183833Protein L-arabinose isomerase AraA [142761] (1 species)
  7. 1183834Species Escherichia coli [TaxId:562] [142762] (2 PDB entries)
    Uniprot P08202 1-328
  8. 1183835Domain d2ajta2: 2ajt A:1-328 [126895]
    Other proteins in same PDB: d2ajta1, d2ajtb1, d2ajtc1

Details for d2ajta2

PDB Entry: 2ajt (more details), 2.6 Å

PDB Description: crystal structure of l-arabinose isomerase from e.coli
PDB Compounds: (A:) L-arabinose isomerase

SCOPe Domain Sequences for d2ajta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajta2 c.85.1.2 (A:1-328) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]}
mtifdnyevwfvigsqhlygpetlrqvtqhaehvvnalnteaklpcklvlkplgttpdei
taicrdanyddpcaglvvwlhtfspakmwingltmlnkpllqfhtqfnaalpwdsidmdf
mnlnqtahggrefgfigarmrqqhavvtghwqdkqaherigswmrqavskqdtrhlkvcr
fgdnmrevavtdgdkvaaqikfgfsvntwavgdlvqvvnsisdgdvnalvdeyescytmt
patqihgekrqnvleaarielgmkrfleqggfhaftttfedlhglkqlpglavqrlmqqg
ygfagegdwktaallrimkvmstglqgg

SCOPe Domain Coordinates for d2ajta2:

Click to download the PDB-style file with coordinates for d2ajta2.
(The format of our PDB-style files is described here.)

Timeline for d2ajta2: