![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (2 families) ![]() |
![]() | Family b.43.2.2: AraA C-terminal domain-like [141331] (1 protein) C-terminal part of Pfam PF02610 |
![]() | Protein L-arabinose isomerase AraA [141332] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141333] (2 PDB entries) Uniprot P08202 329-498 |
![]() | Domain d2ajta1: 2ajt A:329-498 [126894] Other proteins in same PDB: d2ajta2, d2ajtb2, d2ajtc2 |
PDB Entry: 2ajt (more details), 2.6 Å
SCOPe Domain Sequences for d2ajta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ajta1 b.43.2.2 (A:329-498) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]} tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf
Timeline for d2ajta1:
![]() Domains from other chains: (mouse over for more information) d2ajtb1, d2ajtb2, d2ajtc1, d2ajtc2 |