![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
![]() | Protein Putative sugar kinase TM0828 [82518] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [82519] (1 PDB entry) |
![]() | Domain d2ajrb2: 2ajr B:1-319 [126893] Other proteins in same PDB: d2ajra3, d2ajrb3 automated match to d1o14a_ complexed with act, mg |
PDB Entry: 2ajr (more details), 2.46 Å
SCOPe Domain Sequences for d2ajrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ajrb2 c.72.1.1 (B:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} mvltvtlnpaldreifiedfqvnrlyrindlsktqmspggkginvsialsklgvpsvatg fvggymgkilveelrkisklittnfvyvegetrenieiideknktitainfpgpdvtdmd vnhflrrykmtlskvdcvvisgsippgvnegicnelvrlarergvfvfveqtprlleriy egpefpnvvkpdlrgnhasflgvdlktfddyvklaeklaeksqvsvvsyevkndivatre gvwlirskeeidtshllgagdayvagmvyyfikhganflemakfgfasalaatrrkekym pdleaikkeydhftvervk
Timeline for d2ajrb2: