SCOPe 2.07: Domain d2ajqb_: 2ajq B:

Lineage for d2ajqb_ (2ajq B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d2ajqb_: 2ajq B: [126890]
   Other proteins in same PDB: d2ajqa1, d2ajqa2, d2ajqf1, d2ajqf2
   automated match to d1xoa__
   protein/DNA complex

Details for d2ajqb_

PDB Entry: 2ajq, 2.6 Å

PDB Description: structure of replicative dna polymerase provides insigts into the mechanisms for processivity, frameshifting and editing

PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d2ajqb_:

Sequence; same for both SEQRES and ATOM records:

>d2ajqb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

Timeline for d2ajqb_:

• d2ajqb_ first appeared in SCOP 1.73, called d2ajqb1
  
• d2ajqb_ appears in SCOPe 2.06
  
• d2ajqb_ appears in the current release, SCOPe 2.08