![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
![]() | Protein Thioredoxin [52835] (16 species) |
![]() | Species Escherichia coli [TaxId:562] [52836] (55 PDB entries) Uniprot P00274 ! Uniprot P00581 |
![]() | Domain d2ajqb_: 2ajq B: [126890] Other proteins in same PDB: d2ajqa1, d2ajqa2, d2ajqf1, d2ajqf2 automated match to d1xoa__ protein/DNA complex |
PDB Entry: 2ajq (more details), 2.6 Å
SCOPe Domain Sequences for d2ajqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ajqb_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]} kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
Timeline for d2ajqb_: