Lineage for d2ajff_ (2ajf F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616505Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 2616506Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
    automatically mapped to Pfam PF09408
  5. 2616507Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 2616508Protein Spike protein S1 [143589] (4 species)
  7. 2616514Species SARS coronavirus [TaxId:227859] [143590] (14 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 2616528Domain d2ajff_: 2ajf F: [126885]
    Other proteins in same PDB: d2ajfa_, d2ajfb_
    automated match to d2dd8s1
    complexed with cl, nag, zn

Details for d2ajff_

PDB Entry: 2ajf (more details), 2.9 Å

PDB Description: structure of sars coronavirus spike receptor-binding domain complexed with its receptor
PDB Compounds: (F:) SARS-coronavirus spike protein

SCOPe Domain Sequences for d2ajff_:

Sequence, based on SEQRES records: (download)

>d2ajff_ d.318.1.1 (F:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnv
yadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyry
lrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d2ajff_ d.318.1.1 (F:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfv
vkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgkl
rpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d2ajff_:

Click to download the PDB-style file with coordinates for d2ajff_.
(The format of our PDB-style files is described here.)

Timeline for d2ajff_: