SCOP 1.75: Domain d2ajff1: 2ajf F:323-502

Lineage for d2ajff1 (2ajf F:323-502)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
   part of PfamB PB000266

6. Protein Spike protein S1 [143589] (1 species)

7. Species SARS coronavirus [TaxId:227859] [143590] (5 PDB entries)
   Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502

8. Domain d2ajff1: 2ajf F:323-502 [126885]
   Other proteins in same PDB: d2ajfa1, d2ajfb1
   automatically matched to 2AJF E:323-502
   complexed with bma, cl, nag, zn

Details for d2ajff1

PDB Entry: 2ajf, 2.9 Å

PDB Description: structure of sars coronavirus spike receptor-binding domain complexed with its receptor

PDB Compounds: (F:) SARS-coronavirus spike protein

SCOP Domain Sequences for d2ajff1:

Sequence, based on SEQRES records:

>d2ajff1 d.318.1.1 (F:323-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnv
yadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyry
lrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records):

>d2ajff1 d.318.1.1 (F:323-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfv
vkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgkl
rpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Timeline for d2ajff1:

• d2ajff1 first appeared in SCOP 1.73
  
• d2ajff1 is called d2ajff_ in SCOPe 2.01
  
• d2ajff1 appears in the current release, SCOPe 2.08, called d2ajff_