![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
![]() | Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) ![]() |
![]() | Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein) part of PfamB 000266 |
![]() | Protein Spike protein S1 [143589] (1 species) |
![]() | Species SARS coronavirus [TaxId:227859] [143590] (4 PDB entries) |
![]() | Domain d2ajff1: 2ajf F:323-502 [126885] Other proteins in same PDB: d2ajfa1, d2ajfb1 automatically matched to 2AJF E:323-502 complexed with bma, cl, nag, zn |
PDB Entry: 2ajf (more details), 2.9 Å
SCOP Domain Sequences for d2ajff1:
Sequence, based on SEQRES records: (download)
>d2ajff1 d.318.1.1 (F:323-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]} cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnv yadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyry lrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe
>d2ajff1 d.318.1.1 (F:323-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]} cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfv vkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgkl rpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe
Timeline for d2ajff1: