Lineage for d2ajfe1 (2ajf E:323-502)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882461Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 882462Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
  5. 882463Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 882464Protein Spike protein S1 [143589] (1 species)
  7. 882465Species SARS coronavirus [TaxId:227859] [143590] (5 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 882473Domain d2ajfe1: 2ajf E:323-502 [126884]
    Other proteins in same PDB: d2ajfa1, d2ajfb1
    complexed with bma, cl, nag, zn

Details for d2ajfe1

PDB Entry: 2ajf (more details), 2.9 Å

PDB Description: structure of sars coronavirus spike receptor-binding domain complexed with its receptor
PDB Compounds: (E:) SARS-coronavirus spike protein

SCOP Domain Sequences for d2ajfe1:

Sequence, based on SEQRES records: (download)

>d2ajfe1 d.318.1.1 (E:323-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnv
yadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyry
lrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d2ajfe1 d.318.1.1 (E:323-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
cpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfv
vkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgkl
rpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvlsfe

SCOP Domain Coordinates for d2ajfe1:

Click to download the PDB-style file with coordinates for d2ajfe1.
(The format of our PDB-style files is described here.)

Timeline for d2ajfe1: