Lineage for d2ajdd2 (2ajd D:509-766)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842718Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
  6. 842725Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 842800Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries)
  8. 842868Domain d2ajdd2: 2ajd D:509-766 [126881]
    Other proteins in same PDB: d2ajda1, d2ajdb1, d2ajdc1, d2ajdd1
    automatically matched to d1orva2
    complexed with bma, bpr, nag, so4

Details for d2ajdd2

PDB Entry: 2ajd (more details), 2.56 Å

PDB Description: porcine dipeptidyl peptidase iv (cd26) in complex with l-pro-boro-l- pro (boropro)
PDB Compounds: (D:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2ajdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajdd2 c.69.1.24 (D:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

SCOP Domain Coordinates for d2ajdd2:

Click to download the PDB-style file with coordinates for d2ajdd2.
(The format of our PDB-style files is described here.)

Timeline for d2ajdd2: