Lineage for d2ajcd1 (2ajc D:39-508)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675578Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 675662Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 675663Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 675670Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 675698Species Pig (Sus scrofa) [TaxId:9823] [89381] (28 PDB entries)
  8. 675710Domain d2ajcd1: 2ajc D:39-508 [126872]
    Other proteins in same PDB: d2ajca2, d2ajcb2, d2ajcc2, d2ajcd2
    automatically matched to d1orva1
    complexed with 2ab, bma, nag, so4

Details for d2ajcd1

PDB Entry: 2ajc (more details), 1.95 Å

PDB Description: porcine dipeptidyl peptidase iv (cd26) in complex with 4-(2- aminoethyl)-benzene sulphonyl fluoride (aebsf)
PDB Compounds: (D:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2ajcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajcd1 b.70.3.1 (D:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

SCOP Domain Coordinates for d2ajcd1:

Click to download the PDB-style file with coordinates for d2ajcd1.
(The format of our PDB-style files is described here.)

Timeline for d2ajcd1: