Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.24: Pseudo ankyrin repeat-like [140860] (1 family) contains three helices per turn of the superhelix |
Family a.118.24.1: Pseudo ankyrin repeat [140861] (1 protein) one repeat consist of 3 helices; there are similarities in the repeat sequence and assembly with the ankyrin repeat (48404) this is a repeat family; one repeat unit is 2aja A:139-174 found in domain |
Protein Hypothetical protein LPG2416 [140862] (1 species) there are regular repeats in the middle part and iess regular superhelical turns at both ends |
Species Legionella pneumophila [TaxId:446] [140863] (1 PDB entry) Uniprot Q5ZSV0 3-348 |
Domain d2ajab_: 2aja B: [126857] automated match to d2ajaa1 |
PDB Entry: 2aja (more details), 2.8 Å
SCOPe Domain Sequences for d2ajab_:
Sequence, based on SEQRES records: (download)
>d2ajab_ a.118.24.1 (B:) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} cnltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknme qvrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllltsdeiv kviqaenyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnr lcelapteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvn pfiarhvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirfll sipgikalaptatipgdanellrlalrlgnqgacalllsipsvlaltkannyyin
>d2ajab_ a.118.24.1 (B:) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} cnltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknme qvrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllsdeivkq aenyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrlcel apteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnpfia rhvnrlkemhdafklsnpvtkseclqgfymlrnlirrndevllddirfllsipgikalap tatipgdanellrlalrlgnqgacalllsipsvlaltkannyyin
Timeline for d2ajab_: