Lineage for d2ajab1 (2aja B:3-348)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647626Superfamily a.118.24: Pseudo ankyrin repeat-like [140860] (1 family) (S)
    contains three helices per turn of the superhelix
  5. 647627Family a.118.24.1: Pseudo ankyrin repeat [140861] (1 protein)
    one repeat consist of 3 helices; there are similarities in the repeat sequence and assembly with the ankyrin repeat (scop_fa 48404)
  6. 647628Protein Hypothetical protein LPG2416 [140862] (1 species)
    there are regular repeats in the middle part and iess regular superhelical turns at both ends
  7. 647629Species Legionella pneumophila [TaxId:446] [140863] (1 PDB entry)
  8. 647631Domain d2ajab1: 2aja B:3-348 [126857]
    automatically matched to 2AJA A:3-348

Details for d2ajab1

PDB Entry: 2aja (more details), 2.8 Å

PDB Description: X-Ray structure of an ankyrin repeat family protein Q5ZSV0 from Legionella pneumophila. Northeast Structural Genomics Consortium target LgR21.
PDB Compounds: (B:) ankyrin repeat family protein

SCOP Domain Sequences for d2ajab1:

Sequence, based on SEQRES records: (download)

>d2ajab1 a.118.24.1 (B:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]}
nltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknmeq
vrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllltsdeivk
viqaenyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrl
celapteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnp
fiarhvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirflls
ipgikalaptatipgdanellrlalrlgnqgacalllsipsvlalt

Sequence, based on observed residues (ATOM records): (download)

>d2ajab1 a.118.24.1 (B:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]}
nltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknmeq
vrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllsdeivkqa
enyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrlcela
pteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnpfiar
hvnrlkemhdafklsnpvtkseclqgfymlrnlirrndevllddirfllsipgikalapt
atipgdanellrlalrlgnqgacalllsipsvlalt

SCOP Domain Coordinates for d2ajab1:

Click to download the PDB-style file with coordinates for d2ajab1.
(The format of our PDB-style files is described here.)

Timeline for d2ajab1: