Lineage for d2ajaa1 (2aja A:3-348)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008007Superfamily a.118.24: Pseudo ankyrin repeat-like [140860] (1 family) (S)
    contains three helices per turn of the superhelix
  5. 2008008Family a.118.24.1: Pseudo ankyrin repeat [140861] (1 protein)
    one repeat consist of 3 helices; there are similarities in the repeat sequence and assembly with the ankyrin repeat (48404)
  6. 2008009Protein Hypothetical protein LPG2416 [140862] (1 species)
    there are regular repeats in the middle part and iess regular superhelical turns at both ends
  7. 2008010Species Legionella pneumophila [TaxId:446] [140863] (1 PDB entry)
    Uniprot Q5ZSV0 3-348
  8. 2008011Domain d2ajaa1: 2aja A:3-348 [126856]

Details for d2ajaa1

PDB Entry: 2aja (more details), 2.8 Å

PDB Description: X-Ray structure of an ankyrin repeat family protein Q5ZSV0 from Legionella pneumophila. Northeast Structural Genomics Consortium target LgR21.
PDB Compounds: (A:) ankyrin repeat family protein

SCOPe Domain Sequences for d2ajaa1:

Sequence, based on SEQRES records: (download)

>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]}
nltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknmeq
vrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllltsdeivk
viqaenyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrl
celapteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnp
fiarhvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirflls
ipgikalaptatipgdanellrlalrlgnqgacalllsipsvlalt

Sequence, based on observed residues (ATOM records): (download)

>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]}
nltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknmeq
vrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllsdeivkqa
enyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrlcela
pteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnpfiar
hvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirfllsipgi
kalaptatipgdanellrlalrlgnqgacalllsipsvlalt

SCOPe Domain Coordinates for d2ajaa1:

Click to download the PDB-style file with coordinates for d2ajaa1.
(The format of our PDB-style files is described here.)

Timeline for d2ajaa1: