![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.24: Pseudo ankyrin repeat-like [140860] (1 family) ![]() contains three helices per turn of the superhelix |
![]() | Family a.118.24.1: Pseudo ankyrin repeat [140861] (1 protein) one repeat consist of 3 helices; there are similarities in the repeat sequence and assembly with the ankyrin repeat (48404) this is a repeat family; one repeat unit is 2aja A:139-174 found in domain |
![]() | Protein Hypothetical protein LPG2416 [140862] (1 species) there are regular repeats in the middle part and iess regular superhelical turns at both ends |
![]() | Species Legionella pneumophila [TaxId:446] [140863] (1 PDB entry) Uniprot Q5ZSV0 3-348 |
![]() | Domain d2ajaa1: 2aja A:3-348 [126856] |
PDB Entry: 2aja (more details), 2.8 Å
SCOPe Domain Sequences for d2ajaa1:
Sequence, based on SEQRES records: (download)
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} nltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknmeq vrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllltsdeivk viqaenyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrl celapteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnp fiarhvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirflls ipgikalaptatipgdanellrlalrlgnqgacalllsipsvlalt
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} nltihnienyendpqlrlipwilwenlfqhfisanelslmtlsykeaihiflpgtknmeq vrqllclyyahynrnakqlwsdahkkgiksevicfvaaitgcssaldtlcllsdeivkqa enyqafrlaaenghlhvlnrlcelapteimamiqaenyhafrlaaenghlhvlnrlcela pteatamiqaenyyafrwaavgrghhnvinflldcpvmlayaeihefeygekyvnpfiar hvnrlkemhdafklsnpdgvfdlvtkseclqgfymlrnlirrndevllddirfllsipgi kalaptatipgdanellrlalrlgnqgacalllsipsvlalt
Timeline for d2ajaa1: