SCOPe 2.08: Domain d2aj8d2: 2aj8 D:509-766

Lineage for d2aj8d2 (2aj8 D:509-766)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89771] (8 PDB entries)

8. Domain d2aj8d2: 2aj8 D:509-766 [126851]
   Other proteins in same PDB: d2aj8a1, d2aj8b1, d2aj8c1, d2aj8d1
   automated match to d1orva2
   complexed with nag, sc3, so4

Details for d2aj8d2

PDB Entry: 2aj8, 2.11 Å

PDB Description: porcine dipeptidyl peptidase iv (cd26) in complex with 7-benzyl-1,3- dimethyl-8-piperazin-1-yl-3,7-dihydro-purine-2,6-dione (bdpx)

PDB Compounds: (D:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2aj8d2:

Sequence; same for both SEQRES and ATOM records:

>d2aj8d2 c.69.1.24 (D:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

Timeline for d2aj8d2:

• d2aj8d2 first appeared in SCOP 1.73
  
• d2aj8d2 appears in SCOPe 2.07