SCOPe 2.07: Domain d2aj8c1: 2aj8 C:39-508

Lineage for d2aj8c1 (2aj8 C:39-508)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries)

8. Domain d2aj8c1: 2aj8 C:39-508 [126848]
   Other proteins in same PDB: d2aj8a2, d2aj8b2, d2aj8c2, d2aj8d2
   automated match to d1orva1
   complexed with bma, nag, sc3, so4

Details for d2aj8c1

PDB Entry: 2aj8, 2.11 Å

PDB Description: porcine dipeptidyl peptidase iv (cd26) in complex with 7-benzyl-1,3- dimethyl-8-piperazin-1-yl-3,7-dihydro-purine-2,6-dione (bdpx)

PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2aj8c1:

Sequence; same for both SEQRES and ATOM records:

>d2aj8c1 b.70.3.1 (C:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

Timeline for d2aj8c1:

• d2aj8c1 first appeared in SCOP 1.73
  
• d2aj8c1 appears in SCOPe 2.06
  
• d2aj8c1 appears in the current release, SCOPe 2.08