Lineage for d2aj8a2 (2aj8 A:509-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901312Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2901319Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2901455Species Pig (Sus scrofa) [TaxId:9823] [89771] (8 PDB entries)
  8. 2901464Domain d2aj8a2: 2aj8 A:509-766 [126845]
    Other proteins in same PDB: d2aj8a1, d2aj8b1, d2aj8c1, d2aj8d1
    automated match to d1orva2
    complexed with nag, sc3, so4

Details for d2aj8a2

PDB Entry: 2aj8 (more details), 2.11 Å

PDB Description: porcine dipeptidyl peptidase iv (cd26) in complex with 7-benzyl-1,3- dimethyl-8-piperazin-1-yl-3,7-dihydro-purine-2,6-dione (bdpx)
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2aj8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aj8a2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

SCOPe Domain Coordinates for d2aj8a2:

Click to download the PDB-style file with coordinates for d2aj8a2.
(The format of our PDB-style files is described here.)

Timeline for d2aj8a2: