Lineage for d2aj7b1 (2aj7 B:1-146)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680980Fold b.158: BH3618-like [141456] (1 superfamily)
    barrel, closed; n=7, S=10; meander
  4. 680981Superfamily b.158.1: BH3618-like [141457] (1 family) (S)
  5. 680982Family b.158.1.1: BH3618-like [141458] (1 protein)
    Pfam PF02623; DUF180
  6. 680983Protein Hypothetical protein BH3618 [141459] (1 species)
    B. subtilis YviF homolog
  7. 680984Species Bacillus halodurans [TaxId:86665] [141460] (1 PDB entry)
  8. 680986Domain d2aj7b1: 2aj7 B:1-146 [126843]
    automatically matched to 2AJ7 A:1-148
    complexed with edo, fmt, k, ni

Details for d2aj7b1

PDB Entry: 2aj7 (more details), 1.67 Å

PDB Description: Crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 A resolution
PDB Compounds: (B:) hypothetical protein BH3618

SCOP Domain Sequences for d2aj7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aj7b1 b.158.1.1 (B:1-146) Hypothetical protein BH3618 {Bacillus halodurans [TaxId: 86665]}
mkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyytlqstktvdlafi
ivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettvnlqapivinank
qmgkqlvlgdtaynrkqplfqkelvl

SCOP Domain Coordinates for d2aj7b1:

Click to download the PDB-style file with coordinates for d2aj7b1.
(The format of our PDB-style files is described here.)

Timeline for d2aj7b1: