SCOPe 2.08: Domain d2aj7b2: 2aj7 B:1-146

Lineage for d2aj7b2 (2aj7 B:1-146)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.158: BH3618-like [141456] (1 superfamily)
   barrel, closed; n=7, S=10; meander

4. Superfamily b.158.1: BH3618-like [141457] (1 family)

5. Family b.158.1.1: BH3618-like [141458] (1 protein)
   Pfam PF02623; DUF180

6. Protein Hypothetical protein BH3618 [141459] (1 species)
   B. subtilis YviF homolog

7. Species Bacillus halodurans [TaxId:86665] [141460] (1 PDB entry)
   Uniprot Q9K6V7 1-148

8. Domain d2aj7b2: 2aj7 B:1-146 [126843]
   Other proteins in same PDB: d2aj7a2, d2aj7b3
   automated match to d2aj7a1
   complexed with edo, fmt, k, ni

Details for d2aj7b2

PDB Entry: 2aj7, 1.67 Å

PDB Description: Crystal structure of a putative contractile protein (bh3618) from bacillus halodurans at 1.67 A resolution

PDB Compounds: (B:) hypothetical protein BH3618

SCOPe Domain Sequences for d2aj7b2:

Sequence; same for both SEQRES and ATOM records:

>d2aj7b2 b.158.1.1 (B:1-146) Hypothetical protein BH3618 {Bacillus halodurans [TaxId: 86665]}
mkvietkysgklevaedrliafdqgipafedekefvllpfaagtpyytlqstktvdlafi
ivnpfsffpeyrvklpeatiaqlnitnendvaifslltvkepfsettvnlqapivinank
qmgkqlvlgdtaynrkqplfqkelvl

Timeline for d2aj7b2:

• d2aj7b2 first appeared in SCOP 1.73, called d2aj7b1
  
• d2aj7b2 appears in SCOPe 2.07