Lineage for d2aj2a1 (2aj2 A:14-192)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616401Fold d.310: VC0467-like [143455] (1 superfamily)
    complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel
  4. 2616402Superfamily d.310.1: VC0467-like [143456] (2 families) (S)
    automatically mapped to Pfam PF02622
  5. 2616403Family d.310.1.1: VC0467-like [143457] (5 proteins)
    Pfam PF02622; DUF179
  6. 2616417Protein Hypothetical protein VC0467 [143462] (1 species)
  7. 2616418Species Vibrio cholerae [TaxId:666] [143463] (2 PDB entries)
    Uniprot Q9KUP8 1-177! Uniprot Q9KUP8 1-179
  8. 2616420Domain d2aj2a1: 2aj2 A:14-192 [126840]
    Other proteins in same PDB: d2aj2a2

Details for d2aj2a1

PDB Entry: 2aj2 (more details), 3.21 Å

PDB Description: X-Ray Crystal Structure of Protein VC0467 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR8.
PDB Compounds: (A:) Hypothetical UPF0301 protein VC0467

SCOPe Domain Sequences for d2aj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aj2a1 d.310.1.1 (A:14-192) Hypothetical protein VC0467 {Vibrio cholerae [TaxId: 666]}
mnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdiepay
pqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteae
pegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgispaq

SCOPe Domain Coordinates for d2aj2a1:

Click to download the PDB-style file with coordinates for d2aj2a1.
(The format of our PDB-style files is described here.)

Timeline for d2aj2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aj2a2