Lineage for d2aj2a1 (2aj2 A:14-192)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741694Fold d.310: VC0467-like [143455] (1 superfamily)
    complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel
  4. 741695Superfamily d.310.1: VC0467-like [143456] (1 family) (S)
  5. 741696Family d.310.1.1: VC0467-like [143457] (5 proteins)
    Pfam PF02622; DUF179
  6. 741710Protein Hypothetical protein VC0467 [143462] (1 species)
  7. 741711Species Vibrio cholerae [TaxId:666] [143463] (2 PDB entries)
  8. 741713Domain d2aj2a1: 2aj2 A:14-192 [126840]

Details for d2aj2a1

PDB Entry: 2aj2 (more details), 3.21 Å

PDB Description: X-Ray Crystal Structure of Protein VC0467 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR8.
PDB Compounds: (A:) Hypothetical UPF0301 protein VC0467

SCOP Domain Sequences for d2aj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aj2a1 d.310.1.1 (A:14-192) Hypothetical protein VC0467 {Vibrio cholerae [TaxId: 666]}
mnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdiepay
pqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteae
pegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgispaq

SCOP Domain Coordinates for d2aj2a1:

Click to download the PDB-style file with coordinates for d2aj2a1.
(The format of our PDB-style files is described here.)

Timeline for d2aj2a1: