![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.310: VC0467-like [143455] (1 superfamily) complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel |
![]() | Superfamily d.310.1: VC0467-like [143456] (2 families) ![]() automatically mapped to Pfam PF02622 |
![]() | Family d.310.1.1: VC0467-like [143457] (5 proteins) Pfam PF02622; DUF179 |
![]() | Protein Hypothetical protein VC0467 [143462] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [143463] (2 PDB entries) Uniprot Q9KUP8 1-177! Uniprot Q9KUP8 1-179 |
![]() | Domain d2aj2a1: 2aj2 A:14-192 [126840] Other proteins in same PDB: d2aj2a2 |
PDB Entry: 2aj2 (more details), 3.21 Å
SCOPe Domain Sequences for d2aj2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aj2a1 d.310.1.1 (A:14-192) Hypothetical protein VC0467 {Vibrio cholerae [TaxId: 666]} mnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdiepay pqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteae pegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgispaq
Timeline for d2aj2a1: