Lineage for d2aj2a1 (2aj2 A:14-192)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.310: VC0467-like [143455] (1 superfamily)
complex fold; contains bifurcated beta-sheet structure folded into pseudo barrelSuperfamily d.310.1: VC0467-like [143456] (2 families) 
automatically mapped to Pfam PF02622Family d.310.1.1: VC0467-like [143457] (5 proteins)
Pfam PF02622; DUF179
Protein Hypothetical protein VC0467 [143462] (1 species) Species Vibrio cholerae [TaxId:666] [143463] (2 PDB entries)
Uniprot Q9KUP8 1-177! Uniprot Q9KUP8 1-179
Domain d2aj2a1: 2aj2 A:14-192 [126840]
Other proteins in same PDB: d2aj2a2
Details for d2aj2a1
PDB Entry: 2aj2 (more details), 3.21 Å
PDB Description: X-Ray Crystal Structure of Protein VC0467 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR8.
PDB Compounds: (A:) Hypothetical UPF0301 protein VC0467SCOPe Domain Sequences for d2aj2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aj2a1 d.310.1.1 (A:14-192) Hypothetical protein VC0467 {Vibrio cholerae [TaxId: 666]}
mnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdiepay
pqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteae
pegyivalgysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgispaq
SCOPe Domain Coordinates for d2aj2a1:
Click to download the PDB-style file with coordinates for d2aj2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aj2a1:
- d2aj2a1 first appeared in SCOP 1.73
- d2aj2a1 appears in SCOPe 2.07
View in 3D
