SCOPe 2.08: Domain d2airh1: 2air H:1-100

Lineage for d2airh1 (2air H:1-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
   Uniprot P00478

8. Domain d2airh1: 2air H:1-100 [126836]
   Other proteins in same PDB: d2aira1, d2aira2, d2airb2, d2airg1, d2airg2, d2airh2
   automated match to d1d09b1
   complexed with al0, cp, zn

Details for d2airh1

PDB Entry: 2air, 2 Å

PDB Description: t-state active site of aspartate transcarbamylase:crystal structure of the carbamyl phosphate and l-alanosine ligated enzyme

PDB Compounds: (H:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2airh1:

Sequence; same for both SEQRES and ATOM records:

>d2airh1 d.58.2.1 (H:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d2airh1:

• d2airh1 first appeared in SCOP 1.73
  
• d2airh1 appears in SCOPe 2.07