Lineage for d2airg2 (2air G:151-310)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873962Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1873963Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1873964Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 1873965Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)
  7. 1873973Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 1874025Domain d2airg2: 2air G:151-310 [126835]
    Other proteins in same PDB: d2airb1, d2airb2, d2airh1, d2airh2
    automated match to d3csua2
    complexed with al0, cp, zn

Details for d2airg2

PDB Entry: 2air (more details), 2 Å

PDB Description: t-state active site of aspartate transcarbamylase:crystal structure of the carbamyl phosphate and l-alanosine ligated enzyme
PDB Compounds: (G:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d2airg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2airg2 c.78.1.1 (G:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d2airg2:

Click to download the PDB-style file with coordinates for d2airg2.
(The format of our PDB-style files is described here.)

Timeline for d2airg2: