SCOP 1.75: Domain d2airg2: 2air G:151-310

Lineage for d2airg2 (2air G:151-310)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (50 PDB entries)
   Uniprot P00479

8. Domain d2airg2: 2air G:151-310 [126835]
   Other proteins in same PDB: d2airb1, d2airb2, d2airh1, d2airh2
   automatically matched to d1ekxa2
   complexed with al0, cp, zn

Details for d2airg2

PDB Entry: 2air, 2 Å

PDB Description: t-state active site of aspartate transcarbamylase:crystal structure of the carbamyl phosphate and l-alanosine ligated enzyme

PDB Compounds: (G:) Aspartate carbamoyltransferase catalytic chain

SCOP Domain Sequences for d2airg2:

Sequence; same for both SEQRES and ATOM records:

>d2airg2 c.78.1.1 (G:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d2airg2:

• d2airg2 first appeared in SCOP 1.73
  
• d2airg2 appears in SCOPe 2.01
  
• d2airg2 appears in the current release, SCOPe 2.08