Lineage for d2airb1 (2air B:1-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723615Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 723616Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 723617Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 723621Species Escherichia coli [TaxId:562] [54896] (41 PDB entries)
  8. 723626Domain d2airb1: 2air B:1-100 [126832]
    Other proteins in same PDB: d2aira1, d2aira2, d2airb2, d2airg1, d2airg2, d2airh2
    automatically matched to d1d09b1
    complexed with al0, cp, zn

Details for d2airb1

PDB Entry: 2air (more details), 2 Å

PDB Description: t-state active site of aspartate transcarbamylase:crystal structure of the carbamyl phosphate and l-alanosine ligated enzyme
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d2airb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2airb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d2airb1:

Click to download the PDB-style file with coordinates for d2airb1.
(The format of our PDB-style files is described here.)

Timeline for d2airb1: