Lineage for d2aioa_ (2aio A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603297Species Stenotrophomonas maltophilia [TaxId:40324] [186946] (8 PDB entries)
  8. 2603298Domain d2aioa_: 2aio A: [126829]
    automated match to d1smla_
    complexed with mx1, so4, zn

Details for d2aioa_

PDB Entry: 2aio (more details), 1.7 Å

PDB Description: Metallo beta lactamase L1 from Stenotrophomonas maltophilia complexed with hydrolyzed moxalactam
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2aioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aioa_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d2aioa_:

Click to download the PDB-style file with coordinates for d2aioa_.
(The format of our PDB-style files is described here.)

Timeline for d2aioa_: