Class a: All alpha proteins [46456] (290 folds) |
Fold a.134: Fungal elicitin [48646] (1 superfamily) 5 helices: irregular disulfide-linked array; also contains a small beta-hairpin |
Superfamily a.134.1: Fungal elicitin [48647] (1 family) automatically mapped to Pfam PF00964 |
Family a.134.1.1: Fungal elicitin [48648] (2 proteins) |
Protein beta-cinnamomin [74798] (1 species) |
Species Fungus (Phytophthora cinnamomi) [TaxId:4785] [74799] (3 PDB entries) |
Domain d2aibb_: 2aib B: [126825] automated match to d2aiba1 complexed with erg, gol, mes |
PDB Entry: 2aib (more details), 1.1 Å
SCOPe Domain Sequences for d2aibb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aibb_ a.134.1.1 (B:) beta-cinnamomin {Fungus (Phytophthora cinnamomi) [TaxId: 4785]} tactatqqtaayktlvsilsessfsqcskdsgysmltatalptnaqyklmcastacntmi kkivalnppdcdltvptsglvldvytyangfsskcasl
Timeline for d2aibb_: