SCOPe 2.06: Domain d2ai9b_: 2ai9 B:

Lineage for d2ai9b_ (2ai9 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein automated matches [190200] (9 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [186945] (1 PDB entry)

8. Domain d2ai9b_: 2ai9 B: [126823]
   automated match to d1lqwa_
   complexed with ni, so4

Details for d2ai9b_

PDB Entry: 2ai9, 2.5 Å

PDB Description: S.aureus Polypeptide Deformylase

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d2ai9b_:

Sequence; same for both SEQRES and ATOM records:

>d2ai9b_ d.167.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda
vev

Timeline for d2ai9b_:

• d2ai9b_ first appeared in SCOP 1.73, called d2ai9b1
  
• d2ai9b_ appears in SCOPe 2.05
  
• d2ai9b_ appears in SCOPe 2.07
  
• d2ai9b_ appears in the current release, SCOPe 2.08