Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein automated matches [190200] (9 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [186945] (1 PDB entry) |
Domain d2ai9b_: 2ai9 B: [126823] automated match to d1lqwa_ complexed with ni, so4 |
PDB Entry: 2ai9 (more details), 2.5 Å
SCOPe Domain Sequences for d2ai9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ai9b_ d.167.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda vev
Timeline for d2ai9b_: