SCOP 1.73: Domain d2ai9b1: 2ai9 B:0-182

Lineage for d2ai9b1 (2ai9 B:0-182)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (1 family)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (1 protein)

6. Protein Peptide deformylase [56422] (9 species)

7. Species Staphylococcus aureus [TaxId:1280] [75579] (5 PDB entries)

8. Domain d2ai9b1: 2ai9 B:0-182 [126823]
   automatically matched to d1lm4a_
   complexed with ni, so4

Details for d2ai9b1

PDB Entry: 2ai9, 2.5 Å

PDB Description: S.aureus Polypeptide Deformylase

PDB Compounds: (B:) Peptide deformylase

SCOP Domain Sequences for d2ai9b1:

Sequence; same for both SEQRES and ATOM records:

>d2ai9b1 d.167.1.1 (B:0-182) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda
vev

Timeline for d2ai9b1:

• d2ai9b1 is new in SCOP 1.73
  
• d2ai9b1 appears in SCOP 1.75
  
• d2ai9b1 appears in the current release, SCOPe 2.08, called d2ai9b_