Lineage for d2ai9a1 (2ai9 A:0-182)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737722Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 737723Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
    nickel-dependent enzyme
  5. 737724Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 737725Protein Peptide deformylase [56422] (9 species)
  7. 737804Species Staphylococcus aureus [TaxId:1280] [75579] (5 PDB entries)
  8. 737811Domain d2ai9a1: 2ai9 A:0-182 [126822]
    automatically matched to d1lm4a_
    complexed with ni, so4

Details for d2ai9a1

PDB Entry: 2ai9 (more details), 2.5 Å

PDB Description: S.aureus Polypeptide Deformylase
PDB Compounds: (A:) Peptide deformylase

SCOP Domain Sequences for d2ai9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ai9a1 d.167.1.1 (A:0-182) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda
vev

SCOP Domain Coordinates for d2ai9a1:

Click to download the PDB-style file with coordinates for d2ai9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ai9a1: