SCOPe 2.08: Domain d2ai9a_: 2ai9 A:

Lineage for d2ai9a_ (2ai9 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Staphylococcus aureus [TaxId:1280] [75579] (9 PDB entries)
   Uniprot Q9F4L4

8. Domain d2ai9a_: 2ai9 A: [126822]
   automated match to d1lqwa_
   complexed with ni, so4

Details for d2ai9a_

PDB Entry: 2ai9, 2.5 Å

PDB Description: S.aureus Polypeptide Deformylase

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d2ai9a_:

Sequence; same for both SEQRES and ATOM records:

>d2ai9a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda
vev

Timeline for d2ai9a_:

• d2ai9a_ first appeared in SCOP 1.73, called d2ai9a1
  
• d2ai9a_ appears in SCOPe 2.07