SCOP 1.73: Domain d2ai8b1: 2ai8 B:1-164

Lineage for d2ai8b1 (2ai8 B:1-164)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (1 family)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (1 protein)

6. Protein Peptide deformylase [56422] (9 species)

7. Species Escherichia coli [TaxId:562] [56423] (19 PDB entries)

8. Domain d2ai8b1: 2ai8 B:1-164 [126820]
   automatically matched to d1bs4a_
   complexed with ni, sb7

Details for d2ai8b1

PDB Entry: 2ai8, 1.7 Å

PDB Description: E.coli Polypeptide Deformylase complexed with SB-485343

PDB Compounds: (B:) Peptide deformylase

SCOP Domain Sequences for d2ai8b1:

Sequence; same for both SEQRES and ATOM records:

>d2ai8b1 d.167.1.1 (B:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrl

Timeline for d2ai8b1:

• d2ai8b1 is new in SCOP 1.73
  
• d2ai8b1 appears in SCOP 1.75
  
• d2ai8b1 appears in the current release, SCOPe 2.08, called d2ai8b_