SCOPe 2.08: Domain d2ai8b_: 2ai8 B:

Lineage for d2ai8b_ (2ai8 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Escherichia coli [TaxId:562] [56423] (21 PDB entries)

8. Domain d2ai8b_: 2ai8 B: [126820]
   automated match to d1bs4a_
   complexed with ni, sb7

Details for d2ai8b_

PDB Entry: 2ai8, 1.7 Å

PDB Description: E.coli Polypeptide Deformylase complexed with SB-485343

PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d2ai8b_:

Sequence; same for both SEQRES and ATOM records:

>d2ai8b_ d.167.1.1 (B:) Peptide deformylase {Escherichia coli [TaxId: 562]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrl

Timeline for d2ai8b_:

• d2ai8b_ first appeared in SCOP 1.73, called d2ai8b1
  
• d2ai8b_ appears in SCOPe 2.07