Lineage for d2ai6a1 (2ai6 A:1-125)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616710Fold d.322: PHP14-like [143723] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest
  4. 2616711Superfamily d.322.1: PHP14-like [143724] (2 families) (S)
  5. 2616712Family d.322.1.1: Janus/Ocnus [143725] (1 protein)
    Pfam PF05005
  6. 2616713Protein Phosphohistidine phosphatase 1, PHP14 [143726] (1 species)
    Janus-A homolog
  7. 2616714Species Human (Homo sapiens) [TaxId:9606] [143727] (5 PDB entries)
    Uniprot Q9NRX4 1-125! Uniprot Q9NRX4 2-121! Uniprot Q9NRX4 5-122
  8. 2616721Domain d2ai6a1: 2ai6 A:1-125 [126818]

Details for d2ai6a1

PDB Entry: 2ai6 (more details)

PDB Description: solution structure of human phosphohistidine phosphatase 1
PDB Compounds: (A:) 14 kDa phosphohistidine phosphatase

SCOPe Domain Sequences for d2ai6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ai6a1 d.322.1.1 (A:1-125) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv
sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw
andgy

SCOPe Domain Coordinates for d2ai6a1:

Click to download the PDB-style file with coordinates for d2ai6a1.
(The format of our PDB-style files is described here.)

Timeline for d2ai6a1: