SCOP 1.75: Domain d2ai6a1: 2ai6 A:1-125

Lineage for d2ai6a1 (2ai6 A:1-125)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.322: PHP14-like [143723] (1 superfamily)
   beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest

4. Superfamily d.322.1: PHP14-like [143724] (2 families)

5. Family d.322.1.1: Janus/Ocnus [143725] (1 protein)
   Pfam PF05005

6. Protein Phosphohistidine phosphatase 1, PHP14 [143726] (1 species)
   Janus-A homolog

7. Species Human (Homo sapiens) [TaxId:9606] [143727] (5 PDB entries)
   Uniprot Q9NRX4 1-125! Uniprot Q9NRX4 2-121! Uniprot Q9NRX4 5-122

8. Domain d2ai6a1: 2ai6 A:1-125 [126818]

Details for d2ai6a1

PDB Entry: 2ai6

PDB Description: solution structure of human phosphohistidine phosphatase 1

PDB Compounds: (A:) 14 kDa phosphohistidine phosphatase

SCOP Domain Sequences for d2ai6a1:

Sequence; same for both SEQRES and ATOM records:

>d2ai6a1 d.322.1.1 (A:1-125) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv
sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw
andgy

Timeline for d2ai6a1:

• d2ai6a1 first appeared in SCOP 1.73
  
• d2ai6a1 appears in SCOPe 2.01
  
• d2ai6a1 appears in the current release, SCOPe 2.08