SCOP 1.73: Domain d2ai5a1: 2ai5 A:1-80

Lineage for d2ai5a1 (2ai5 A:1-80)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c552 [46636] (5 species)

7. Species Hydrogenobacter thermophilus [TaxId:940] [46640] (3 PDB entries)

8. Domain d2ai5a1: 2ai5 A:1-80 [126817]
   automatically matched to d1ayg__
   complexed with hec

Details for d2ai5a1

PDB Entry: 2ai5

PDB Description: solution structure of cytochrome c552, determined by distributed computing implementation for nmr data

PDB Compounds: (A:) Cytochrome c-552

SCOP Domain Sequences for d2ai5a1:

Sequence; same for both SEQRES and ATOM records:

>d2ai5a1 a.3.1.1 (A:1-80) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsik

Timeline for d2ai5a1:

• d2ai5a1 is new in SCOP 1.73
  
• d2ai5a1 appears in SCOP 1.75
  
• d2ai5a1 appears in the current release, SCOPe 2.08, called d2ai5a_