Lineage for d2ai1a_ (2ai1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2495769Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2495793Species Cow (Bos taurus) [TaxId:9913] [53171] (20 PDB entries)
    Uniprot P55859
  8. 2495812Domain d2ai1a_: 2ai1 A: [126813]
    automated match to d1a9o__
    complexed with 144, mg, p1g, zn

Details for d2ai1a_

PDB Entry: 2ai1 (more details), 2 Å

PDB Description: Purine nucleoside phosphorylase from calf spleen
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d2ai1a_:

Sequence, based on SEQRES records: (download)

>d2ai1a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
ngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvp
ghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnp
nfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmg
eqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslit
nkvimdyesqgkanheevleagkqaaqkleqfvsllmasi

Sequence, based on observed residues (ATOM records): (download)

>d2ai1a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
ngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpesgrl
vfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpnfevgd
imlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmgeqrelq
egtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitnkvimd
yesqgkanheevleagkqaaqkleqfvsllmasi

SCOPe Domain Coordinates for d2ai1a_:

Click to download the PDB-style file with coordinates for d2ai1a_.
(The format of our PDB-style files is described here.)

Timeline for d2ai1a_: