Lineage for d2ai1a1 (2ai1 A:3-282)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 837625Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 837626Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 837718Protein Purine nucleoside phosphorylase, PNP [53169] (9 species)
  7. 837735Species Cow (Bos taurus) [TaxId:9913] [53171] (20 PDB entries)
    Uniprot P55859
  8. 837749Domain d2ai1a1: 2ai1 A:3-282 [126813]
    automatically matched to d1v48a_
    complexed with 144, mg, p1g, zn

Details for d2ai1a1

PDB Entry: 2ai1 (more details), 2 Å

PDB Description: Purine nucleoside phosphorylase from calf spleen
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOP Domain Sequences for d2ai1a1:

Sequence, based on SEQRES records: (download)

>d2ai1a1 c.56.2.1 (A:3-282) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
ngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvp
ghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnp
nfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmg
eqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslit
nkvimdyesqgkanheevleagkqaaqkleqfvsllmasi

Sequence, based on observed residues (ATOM records): (download)

>d2ai1a1 c.56.2.1 (A:3-282) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}
ngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpesgrl
vfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpnfevgd
imlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkqmgeqrelq
egtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitnkvimd
yesqgkanheevleagkqaaqkleqfvsllmasi

SCOP Domain Coordinates for d2ai1a1:

Click to download the PDB-style file with coordinates for d2ai1a1.
(The format of our PDB-style files is described here.)

Timeline for d2ai1a1: