SCOP 1.73: Domain d2ai0k1: 2ai0 K:124-223

Lineage for d2ai0k1 (2ai0 K:124-223)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d2ai0k1: 2ai0 K:124-223 [126812]
   automatically matched to d1fnsh2
   complexed with gol, so4

Details for d2ai0k1

PDB Entry: 2ai0, 2.2 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form iii

PDB Compounds: (K:) immunoglobulin heavy chain

SCOP Domain Sequences for d2ai0k1:

Sequence; same for both SEQRES and ATOM records:

>d2ai0k1 b.1.1.2 (K:124-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d2ai0k1:

• d2ai0k1 is new in SCOP 1.73
  
• d2ai0k1 appears in SCOP 1.75
  
• d2ai0k1 appears in the current release, SCOPe 2.08, called d2ai0k_