Lineage for d2ai0i_ (2ai0 I:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. Domain d2ai0i_: 2ai0 I: [126810]
    Other proteins in same PDB: d2ai0l2, d2ai0m2, d2ai0n2, d2ai0o2
    automated match to d6shgh_
    complexed with gol, so4

Details for d2ai0i_

PDB Entry: 2ai0 (more details), 2.2 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form iii
PDB Compounds: (I:) immunoglobulin heavy chain

SCOPe Domain Sequences for d2ai0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ai0i_ b.1.1.1 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvklvesggglvkpggslrlscaasgftfrnygmswvrqtpekrlewvaaisgnslytsy
pdsvkgrftisrdnaknnlylqmsslrsedtalyfcarhddyygkspyffdvwgagttvt
assakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d2ai0i_ are not available.

Timeline for d2ai0i_:

Domains from other chains:
(mouse over for more information)
d2ai0h_, d2ai0j_, d2ai0k_, d2ai0l1, d2ai0l2, d2ai0m1, d2ai0m2, d2ai0n1, d2ai0n2, d2ai0o1, d2ai0o2