Lineage for d2ahwb1 (2ahw B:284-529)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922432Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 2922437Protein Putative enzyme YdiF C-terminal domain [142194] (1 species)
  7. 2922438Species Escherichia coli [TaxId:562] [142195] (3 PDB entries)
    Uniprot P37766 283-529
  8. 2922448Domain d2ahwb1: 2ahw B:284-529 [126803]
    Other proteins in same PDB: d2ahwa2, d2ahwb2, d2ahwc2, d2ahwd2
    automated match to d2ahua1
    complexed with coa

Details for d2ahwb1

PDB Entry: 2ahw (more details), 2.15 Å

PDB Description: Crystal Structure of Acyl-CoA transferase from E. coli O157:H7 (YdiF)-thioester complex with CoA- 2
PDB Compounds: (B:) putative enzyme YdiF

SCOPe Domain Sequences for d2ahwb1:

Sequence, based on SEQRES records: (download)

>d2ahwb1 c.124.1.3 (B:284-529) Putative enzyme YdiF C-terminal domain {Escherichia coli [TaxId: 562]}
plnqrklvarralfemrkgavgnvgvgiadgiglvareegcaddfiltvetgpiggitsq
giafganvntraildmtsqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggfi
disatskkiifcgtltagslkteiadgklnivqegrvkkfirelpeitfsgkialergld
vryiteravftlkedglhlieiapgvdlqkdildkmdftpvispelklmderlfidaamg
fvlpea

Sequence, based on observed residues (ATOM records): (download)

>d2ahwb1 c.124.1.3 (B:284-529) Putative enzyme YdiF C-terminal domain {Escherichia coli [TaxId: 562]}
plnqrklvarralfemrkgavgnvgvgiadgiglvareegcaddfiltvetgpiggitan
vntraildmtsqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggfidisatsk
kiifcgtltagslkteiadgklnivqegrvkkfirelpeitfsgkialergldvryiter
avftlkedglhlieiapgvdlqkdildkmdftpvispelklmderlfidaamgfvlpea

SCOPe Domain Coordinates for d2ahwb1:

Click to download the PDB-style file with coordinates for d2ahwb1.
(The format of our PDB-style files is described here.)

Timeline for d2ahwb1: