Lineage for d2ahuc2 (2ahu C:4-276)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885422Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1885423Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1885462Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 1885483Protein Putative enzyme YdiF N-terminal domain [142198] (1 species)
  7. 1885484Species Escherichia coli [TaxId:562] [142199] (3 PDB entries)
    Uniprot P37766 4-276
  8. 1885487Domain d2ahuc2: 2ahu C:4-276 [126790]
    Other proteins in same PDB: d2ahua1, d2ahub1, d2ahuc1, d2ahud1
    automated match to d2ahua2

Details for d2ahuc2

PDB Entry: 2ahu (more details), 1.9 Å

PDB Description: Crystal structure of Acyl-CoA transferase (YdiF) apoenzyme from Escherichia coli O157:H7.
PDB Compounds: (C:) putative enzyme YdiF

SCOPe Domain Sequences for d2ahuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahuc2 c.124.1.2 (C:4-276) Putative enzyme YdiF N-terminal domain {Escherichia coli [TaxId: 562]}
vkppringrvpvlsaqeavnyipdeatlcvlgagggileattlitaladkykqtqtprnl
siisptglgdradrgisplaqeglvkwalcghwgqsprisdlaeqnkiiaynypqgvltq
tlraaaahqpgiisdigigtfvdprqqggklnevtkedliklvefdnkeylyykaiapdi
afirattcdsegyatfedevmyldalviaqavhnnggivmmqvqkmvkkatlhpksvrip
gylvdivvvdpdqsqlyggapvnrfisgdftld

SCOPe Domain Coordinates for d2ahuc2:

Click to download the PDB-style file with coordinates for d2ahuc2.
(The format of our PDB-style files is described here.)

Timeline for d2ahuc2: