Lineage for d2ahua1 (2ahu A:283-529)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151084Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 protein domains)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 2151089Protein Putative enzyme YdiF C-terminal domain [142194] (1 species)
  7. 2151090Species Escherichia coli [TaxId:562] [142195] (3 PDB entries)
    Uniprot P37766 283-529
  8. 2151091Domain d2ahua1: 2ahu A:283-529 [126785]
    Other proteins in same PDB: d2ahua2, d2ahub2, d2ahuc2, d2ahud2

Details for d2ahua1

PDB Entry: 2ahu (more details), 1.9 Å

PDB Description: Crystal structure of Acyl-CoA transferase (YdiF) apoenzyme from Escherichia coli O157:H7.
PDB Compounds: (A:) putative enzyme YdiF

SCOPe Domain Sequences for d2ahua1:

Sequence, based on SEQRES records: (download)

>d2ahua1 c.124.1.3 (A:283-529) Putative enzyme YdiF C-terminal domain {Escherichia coli [TaxId: 562]}
lplnqrklvarralfemrkgavgnvgvgiadgiglvareegcaddfiltvetgpiggits
qgiafganvntraildmtsqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggf
idisatskkiifcgtltagslkteiadgklnivqegrvkkfirelpeitfsgkialergl
dvryiteravftlkedglhlieiapgvdlqkdildkmdftpvispelklmderlfidaam
gfvlpea

Sequence, based on observed residues (ATOM records): (download)

>d2ahua1 c.124.1.3 (A:283-529) Putative enzyme YdiF C-terminal domain {Escherichia coli [TaxId: 562]}
lplnqrklvarralfemrkgavgnvgvgiadgiglvareegcaddfiltvetgpiggits
ganvntraildmtsqfdfyhgggldvcylsfaevdqhgnvgvhkfngkimgtggfidisa
tskkiifcgtltagslkteiadgklnivqegrvkkfirelpeitfsgkialergldvryi
teravftlkedglhlieiapgvdlqkdildkmdftpvispelklmderlfidaamgfvlp
ea

SCOPe Domain Coordinates for d2ahua1:

Click to download the PDB-style file with coordinates for d2ahua1.
(The format of our PDB-style files is described here.)

Timeline for d2ahua1: